PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G188400.1.p
Common NameGLYMA_06G188400, LOC100795381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 331aa    MW: 37118.9 Da    PI: 5.7064
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G188400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.4e-1458100246
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +++Tt+E++l++++++  G++ W+ Ia+ ++ gRt+ ++k++w++
  Glyma.06G188400.1.p  58 DNFTTQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDTDVKNYWNS 100
                          589******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-6654IPR009057Homeodomain-like
PROSITE profilePS500904.704948IPR017877Myb-like domain
SuperFamilySSF466891.29E-191198IPR009057Homeodomain-like
SMARTSM00717101353IPR001005SANT/Myb domain
PROSITE profilePS5129420.81752106IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2255106IPR009057Homeodomain-like
SMARTSM007173.6E-1256104IPR001005SANT/Myb domain
PfamPF002492.7E-1259100IPR001005SANT/Myb domain
CDDcd001671.37E-859102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MARSPSCEKI NVKRGLWTTE EDTKKLAFGS KHGSGLKRCG RSCRIRWTNY PRPDLKDDNF  60
TTQEEDLIIK LHAAIGSRWS IIAQQLPGRT DTDVKNYWNS KLKKKLSQLG IDPVTHKPFS  120
KLIADYGNIG GCQKPSTRIA SINKDFKNAM MLKSESHQTL PEGFITNIND QPKPPPKMET  180
TGNNFLFNRT HGDDLSMNLD QFQAISMKSG ASNCIDFENE IMPVSMFGED CFSKTSSPST  240
PSTCSTTAFS WNDFLLEDAF TPLANQEQDL VSQIEDLTWN KIEVKSLQAS GSDLQFSSAS  300
DISFMEAMLD QENEMFLSFP HLMEEPSKLN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-20141067108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150358e-84AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581947.10.0PREDICTED: transcription factor MYB35-like
TrEMBLK7KVV60.0K7KVV6_SOYBN; Uncharacterized protein
STRINGGLYMA06G20020.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-59MYB family protein